DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and MSI2

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_005257071.1 Gene:MSI2 / 124540 HGNCID:18585 Length:346 Species:Homo sapiens


Alignment Length:297 Identity:170/297 - (57%)
Similarity:195/297 - (65%) Gaps:45/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVD 84
            |.::..:||||||||||||||||:||||||.::|:|.|.|||:||||:||||||||||:||.|||
Human    12 SANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVD 76

  Fly    85 KVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAML 149
            |||.|..||||.|.:||||||||||.|||||||||||||||||.|.:||||.||||||.:|||||
Human    77 KVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAML 141

  Fly   150 MFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGRS- 213
            ||||.||||||||||||::||||:||||||||||||||||||||||||||.|..   ||...|. 
Human   142 MFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPG---TRGRARGL 203

  Fly   214 --------------AYGELVV--------WGSSHAHSTAATSAAAAGLLPSSLAAAA--SVLQQQ 254
                          .|...|.        :..|:.:......|||.|.:.::..|||  |||   
Human   204 PYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSVL--- 265

  Fly   255 QQQQQQQQQQQQQQQQHHQQLHHTHPQSPAHSHAHHP 291
                          ..:..|.:...|.|||.|:...|
Human   266 --------------NSYSAQPNFGAPASPAGSNPARP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 56/73 (77%)
RRM2_MSI 119..192 CDD:240769 62/72 (86%)
MSI2XP_005257071.1 RRM1_MSI2 17..109 CDD:410153 71/91 (78%)
PABP-1234 <35..343 CDD:130689 153/274 (56%)
RRM2_MSI 111..184 CDD:240769 62/72 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145875
Domainoid 1 1.000 124 1.000 Domainoid score I5529
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H62199
Inparanoid 1 1.050 359 1.000 Inparanoid score I2219
Isobase 1 0.950 - 0 Normalized mean entropy S972
OMA 1 1.010 - - QHG47546
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 1 1.000 - - otm42259
orthoMCL 1 0.900 - - OOG6_101082
Panther 1 1.100 - - LDO PTHR48032
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1869
SonicParanoid 1 1.000 - - X310
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.