DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus


Alignment Length:225 Identity:86/225 - (38%)
Similarity:118/225 - (52%) Gaps:25/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIEQQQQQQQVELGPCSP-----SEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKD 63
            ||:..:.::.......||     :....:..|||||||||.|:.:.|:|||.::|::.:..:..|
Mouse    67 KIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLD 131

  Fly    64 PTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAP 128
            |.|.||||||||.|.:..|||||:.|..|:|:||.:|||    |....|.....|||||||||..
Mouse   132 PITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPK----RAKAMKTKEPVKKIFVGGLSPD 192

  Fly   129 TTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA 193
            |..|.::.||..||.:|...|..|.:||:.|||.|:||:.|:.|.|:.|..:|.:.....|.|.|
Mouse   193 TPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

  Fly   194 QPKEVMLPANLAKTRAAGRSAYGELVVWGS 223
            ..||                .|.:...|||
Mouse   258 MSKE----------------QYQQQQQWGS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 39/73 (53%)
RRM2_MSI 119..192 CDD:240769 31/72 (43%)
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 4/23 (17%)
CBFNT <60..78 CDD:311868 2/10 (20%)
RRM1_hnRNPD_like 99..172 CDD:241019 39/76 (51%)
RRM2_hnRNPD 183..257 CDD:241027 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.