DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and SRSF8

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_115285.1 Gene:SRSF8 / 10929 HGNCID:16988 Length:282 Species:Homo sapiens


Alignment Length:82 Identity:29/82 - (35%)
Similarity:49/82 - (59%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSD-PNSVDKVLTQGTHELDG 96
            :..|:::|||:|||..|.:||.:.:..:.::|.|:..|||.||.|.| .::.|........||||
Human    18 VDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDG 82

  Fly    97 KKVDPKVA-FPRRAHPK 112
            :::..:|| :.||..|:
Human    83 RELRVQVARYGRRDLPR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 26/73 (36%)
RRM2_MSI 119..192 CDD:240769
SRSF8NP_115285.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 24/69 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..282 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.