DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7724 and AT1G51405

DIOPT Version :10

Sequence 1:NP_648957.1 Gene:CG7724 / 39918 FlyBaseID:FBgn0036698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_849791.1 Gene:AT1G51405 / 841565 AraportID:AT1G51405 Length:487 Species:Arabidopsis thaliana


Alignment Length:58 Identity:14/58 - (24%)
Similarity:28/58 - (48%) Gaps:11/58 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNKSGEVLLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLDIVPYKNNIGHEETSLLR 59
            |.|..:||          :..|..|:|:..||...:::.::...:|:|. .::.|:||
plant   176 GTKESKVL----------EDEISYLVEKLNELKSPKVKDMEARNFKHNF-DKQASVLR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7724NP_648957.1 Rossmann-fold NAD(P)(+)-binding proteins 8..381 CDD:473865 12/52 (23%)
AT1G51405NP_849791.1 SMC_N 116..>431 CDD:481474 14/58 (24%)

Return to query results.
Submit another query.