DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7724 and AXS2

DIOPT Version :10

Sequence 1:NP_648957.1 Gene:CG7724 / 39918 FlyBaseID:FBgn0036698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_563807.1 Gene:AXS2 / 837341 AraportID:AT1G08200 Length:389 Species:Arabidopsis thaliana


Alignment Length:260 Identity:58/260 - (22%)
Similarity:92/260 - (35%) Gaps:71/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLDIVPYKNNIGHEETSLLRTYVADIGGDLK--- 70
            :.:.|..||:|.||.::|:.....    ::.:||:  |.:.|.|    ||........|.::   
plant    20 ICMIGAGGFIGSHLCEKLMTETPH----KVLALDV--YNDKIKH----LLEPDTVQWAGRIQFHR 74

  Fly    71 -------ALSPIFNGVDGVFHCAASVKIEYPPNY--EELERV--NVNGTLAVVDLCIQNNVKRLV 124
                   .|..:....|...:.||   |..|.:|  ..|:.:  |....|.||..|.:|| |||:
plant    75 INIKHDSRLEGLIKMADLTINLAA---ICTPADYNTRPLDTIYSNFIDALPVVKYCSENN-KRLI 135

  Fly   125 YTSCTSVCFVPFKGRSTFSAVINSTESKTDTPTLDSSTLWEQDNQFLIPGYASSKLRAENIVLNS 189
            :.|...|          :...|.|...| |.|.       .||.:|              .||..
plant   136 HFSTCEV----------YGKTIGSFLPK-DHPL-------RQDPEF--------------YVLKE 168

  Fly   190 NGAP-----LHNQK-EYLATSAMRAPLTYGECDSHFITEIFDFLSTRGWVFPR---IAGVGGKQQ 245
            :.:|     :..|: .|.....:...|.|.|...:.:.  |..:....|:.||   |.|:.|..:
plant   169 DISPCIFGSIEKQRWSYACAKQLIERLVYAEGAENGLE--FTIVRPFNWIGPRMDFIPGIDGPSE 231

  Fly   246  245
            plant   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7724NP_648957.1 Rossmann-fold NAD(P)(+)-binding proteins 8..381 CDD:473865 58/260 (22%)
AXS2NP_563807.1 PLN02427 4..389 CDD:178047 58/260 (22%)

Return to query results.
Submit another query.