DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7724 and UXS3

DIOPT Version :10

Sequence 1:NP_648957.1 Gene:CG7724 / 39918 FlyBaseID:FBgn0036698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001078768.1 Gene:UXS3 / 836047 AraportID:AT5G59290 Length:357 Species:Arabidopsis thaliana


Alignment Length:134 Identity:42/134 - (31%)
Similarity:64/134 - (47%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGGSGFLGQHLIKQLLE-RKEEL--------GIKEIRSLDIVPYKNNIGHEETSLLRTYVAD 64
            :|::||:||:|.||:.:|:| .|.|:        |.||       ..|..|||....|:|..|.:
plant    47 ILISGGAGFIGSHLVDKLMENEKNEVVVADNYFTGSKE-------NLKKWIGHPRFELIRHDVTE 104

  Fly    65 IGGDLKALSPIFNGVDGVFH--CAASVKIEYPPNYEELERVNVNGTLAVVDLCIQNNVKRLVYTS 127
                     |:...||.::|  |.|| .|.|..|..:..:.||.|||.::.|..:... |::.||
plant   105 ---------PLLIEVDRIYHLACPAS-PIFYKYNPVKTIKTNVIGTLNMLGLAKRVGA-RILLTS 158

  Fly   128 CTSV 131
            .:.|
plant   159 TSEV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7724NP_648957.1 Rossmann-fold NAD(P)(+)-binding proteins 8..381 CDD:473865 42/134 (31%)
UXS3NP_001078768.1 UGD_SDR_e 45..349 CDD:187541 42/134 (31%)

Return to query results.
Submit another query.