DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7724 and UXS5

DIOPT Version :10

Sequence 1:NP_648957.1 Gene:CG7724 / 39918 FlyBaseID:FBgn0036698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_190228.1 Gene:UXS5 / 823794 AraportID:AT3G46440 Length:341 Species:Arabidopsis thaliana


Alignment Length:131 Identity:40/131 - (30%)
Similarity:65/131 - (49%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLD--IVPYKNN----IGHEETSLLRTYVADIGG 67
            :|::||:||:|.||:.:|:|.::    .|:...|  ....|:|    |||....|:|..|.:   
plant    31 ILISGGAGFIGSHLVDKLMENEK----NEVIVADNYFTGSKDNLKKWIGHPRFELIRHDVTE--- 88

  Fly    68 DLKALSPIFNGVDGVFH--CAASVKIEYPPNYEELERVNVNGTLAVVDLCIQNNVKRLVYTSCTS 130
                  |:...||.::|  |.|| .|.|..|..:..:.||.|||.::.|..:... |::.||.:.
plant    89 ------PLLIEVDQIYHLACPAS-PIFYKYNPVKTIKTNVIGTLNMLGLAKRVGA-RILLTSTSE 145

  Fly   131 V 131
            |
plant   146 V 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7724NP_648957.1 Rossmann-fold NAD(P)(+)-binding proteins 8..381 CDD:473865 40/131 (31%)
UXS5NP_190228.1 UGD_SDR_e 29..333 CDD:187541 40/131 (31%)

Return to query results.
Submit another query.