DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7724 and AXS1

DIOPT Version :10

Sequence 1:NP_648957.1 Gene:CG7724 / 39918 FlyBaseID:FBgn0036698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_180353.1 Gene:AXS1 / 817332 AraportID:AT2G27860 Length:389 Species:Arabidopsis thaliana


Alignment Length:257 Identity:57/257 - (22%)
Similarity:95/257 - (36%) Gaps:65/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLDIVPYKNNIGH-------EETSLLRTYVADIG 66
            :.:.|..||:|.||.::||.....    ::.:||:  |.:.|.|       |.:..::.:..:|.
plant    20 ICMIGAGGFIGSHLCEKLLTETPH----KVLALDV--YNDKIKHLLEPDTVEWSGRIQFHRINIK 78

  Fly    67 GDLKALSPIFNGVDGVFHCAASVKIEYPPNY--EELERV--NVNGTLAVVDLCIQNNVKRLVYTS 127
            .|.: |..:....|.:.:.||   |..|.:|  ..|:.:  |....|.||..|.:|| |||::.|
plant    79 HDSR-LEGLVKMADLIINLAA---ICTPADYNTRPLDTIYSNFIDALPVVKYCSENN-KRLIHFS 138

  Fly   128 CTSVCFVPFKGRSTFSAVINSTESKTDTPTLDSSTLWEQDNQFLIPGYASSKLRAENIVLNSNGA 192
            ...|          :...|.|...| |.|..|....:                     ||..:.:
plant   139 TCEV----------YGKTIGSFLPK-DHPLRDDPAFY---------------------VLKEDIS 171

  Fly   193 P-----LHNQK-EYLATSAMRAPLTYGECDSHFITEIFDFLSTRGWVFPR---IAGVGGKQQ 245
            |     :..|: .|.....:...|.|.|...:.:.  |..:....|:.||   |.|:.|..:
plant   172 PCIFGSIEKQRWSYACAKQLIERLVYAEGAENGLE--FTIVRPFNWIGPRMDFIPGIDGPSE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7724NP_648957.1 Rossmann-fold NAD(P)(+)-binding proteins 8..381 CDD:473865 57/257 (22%)
AXS1NP_180353.1 PLN02427 4..389 CDD:178047 57/257 (22%)

Return to query results.
Submit another query.