DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rogdi and RAV2

DIOPT Version :9

Sequence 1:NP_730244.1 Gene:rogdi / 39917 FlyBaseID:FBgn0036697 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_010488.1 Gene:RAV2 / 851784 SGDID:S000002610 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:49/266 - (18%)
Similarity:90/266 - (33%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EFEWVLRQEVHAILK-QLRSI---------LVECAHRFPVPL---YENEGKKTEKFILTVSPDQL 144
            |..|::.:    |:| ||.:|         ::|....|.:|:   ..||..|...     || .:
Yeast    26 ECSWLIEE----IVKPQLPNIIDNFSKCLEMLESDQIFKMPVSNGIPNESNKQND-----SP-TV 80

  Fly   145 KAVLTLTGDAITQADISFKLCKAPSQTQRTS--------------------ITHDSPWKLQQVQD 189
            |.|:|..|..|    :.|.:.....|.||..                    :||     |:.:.:
Yeast    81 KGVITRQGQYI----VDFHIVVRFPQFQRGKQVMFRMNTGLNFLLIQFSKIMTH-----LKNILE 136

  Fly   190 AANHLQTAINHIDDVDDSYHFKTSDEVLHVIGNILDALQRGRNSLLVPKKKPIDELIKGRNMKSL 254
            ..|.||.|      .|.|.........:.::.:.|..||.....|:.|:..........::..|:
Yeast   137 ILNQLQVA------TDVSEFVSKFGVAMELLNHSLILLQNPPRDLVFPEDNNFAMKEMFQDCYSV 195

  Fly   255 VPNLPEDLAVSFYLQSHKLIIAVYQLL--NNQGTMRFDSRQAEASVQWLNDVLLLLMNGQKLCQQ 317
            ..:....|.:...|..::|.|.:..|:  ..:.....||:                 .|:..|.|
Yeast   196 CESTAHILGLELTLCRNELCIELRNLIKVTKKPWCEIDSK-----------------TGRSFCDQ 243

  Fly   318 LKDKIS 323
            ::::::
Yeast   244 IRNQVT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rogdiNP_730244.1 Rogdi_lz 93..>280 CDD:287261 43/219 (20%)
RAV2NP_010488.1 Rogdi_lz 26..341 CDD:402049 49/266 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13618
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.