DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rogdi and rogdi

DIOPT Version :9

Sequence 1:NP_730244.1 Gene:rogdi / 39917 FlyBaseID:FBgn0036697 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_002941090.1 Gene:rogdi / 779520 XenbaseID:XB-GENE-958855 Length:288 Species:Xenopus tropicalis


Alignment Length:287 Identity:108/287 - (37%)
Similarity:155/287 - (54%) Gaps:33/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SAMKMLADTEREEALNLQIEFEWVLRQEVHAILKQLRSILVECAHRFPVPLYENEG-KKTEKFIL 137
            :|....:.|||..   |:.||:|:|::|||::||||:.||.|.:.||.:|....|| .|.|.|.|
 Frog     3 TAAASASSTERSV---LEEEFKWLLKEEVHSVLKQLQDILKEASRRFTLPGGVGEGPTKQENFAL 64

  Fly   138 -TVSPDQLKAVLTLTGDAITQADISFKLCKAPSQTQRTSITHDSPWKLQQVQDAANHLQTAINHI 201
             |.|.||:|.:|||.||.:.||:::.|..:. :|....:...|..||:||:|||.||:..||..:
 Frog    65 GTTSSDQVKGILTLQGDTLCQAEVNLKTLRT-NQLLHFAFREDKQWKMQQIQDARNHVNQAIYLL 128

  Fly   202 DDVDDSYHFKTSDEVLHVIGNILDALQRGRNSLLVPKKKPIDELIKGRNMKSLVPNLPEDLAVSF 266
            .:..::|.|:|..|||.::..::..|.|.||.|..|....:.|:......|...|.||.|:.::|
 Frog   129 TNRGENYTFQTGAEVLKLMDAVMLQLTRARNRLTTPATMTLPEVATSGLTKMFTPALPPDILLNF 193

  Fly   267 YLQSHKLIIAVYQL------------------LNNQGTM------RFD---SRQAEASVQWLNDV 304
            |:..:||.:.||||                  |:|.|.|      ||:   ..:.|..|.||||.
 Frog   194 YVNVNKLCLLVYQLHALQPNSTKNFRPSGSAVLHNPGAMFELNNQRFEVSHVHKVECVVPWLNDA 258

  Fly   305 LLLLMNGQKLCQQLKDKISVFSVYKDF 331
            |:......:|||||||||||||.|.:|
 Frog   259 LVFFTVSLQLCQQLKDKISVFSSYWNF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rogdiNP_730244.1 Rogdi_lz 93..>280 CDD:287261 73/188 (39%)
rogdiXP_002941090.1 Rogdi_lz 19..277 CDD:370929 104/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11605
Inparanoid 1 1.050 170 1.000 Inparanoid score I4012
OMA 1 1.010 - - QHG46596
OrthoDB 1 1.010 - - D1051737at2759
OrthoFinder 1 1.000 - - FOG0007220
OrthoInspector 1 1.000 - - oto103668
Panther 1 1.100 - - LDO PTHR13618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2769
SonicParanoid 1 1.000 - - X6095
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.