DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rogdi and rav2

DIOPT Version :9

Sequence 1:NP_730244.1 Gene:rogdi / 39917 FlyBaseID:FBgn0036697 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_595763.1 Gene:rav2 / 2541012 PomBaseID:SPBC3H7.12 Length:287 Species:Schizosaccharomyces pombe


Alignment Length:245 Identity:44/245 - (17%)
Similarity:101/245 - (41%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ILTVSP--DQLKAVLTLTGDAITQADISFKLCKAPS--QTQRTSITHDSPWKLQQVQDAANHLQT 196
            ::..||  |.:|.:::.:...:.:.:::.|:.:...  :.:.::|.|     |.|:.:.:|::..
pombe    48 LVFTSPKTDAVKGIVSRSSSNVVRVNVTAKVGRTTHVLKLKDSAIIH-----LDQILNLSNYMHY 107

  Fly   197 AINHIDDV--DDSYHFKTSDEVLHVIGNILDALQ------------------RGRNSLLVPKKKP 241
            |:..:..:  :.....|...|:||.|..:|.::.                  :.:||::.....|
pombe   108 ALYCLPRLRHNTERAIKELQEILHAIVCLLHSIMQEESEKEEIPSNASSISLKSQNSIVSRTSNP 172

  Fly   242 IDELIKG-RNMKSLV------PNLPEDLAVSFYLQSHKLIIAVYQLLNNQGTMR----------- 288
            ...|... |.:...|      |.||.:||:||.:.:..:.:.:::|......:.           
pombe   173 FSCLNHSPRQIHKTVRNHLFSPPLPSNLALSFSISNASVCLHLFRLSGPNEVLESFAKNSVDIEM 237

  Fly   289 ---FDSRQAEASVQWLNDVLLLLMNGQKLCQQLKDKISVFSVYKDFTVGS 335
               |.|::.:|..|   |.:||.:..:  ...|:.|::..| |:..|:.|
pombe   238 LKPFVSQRIDAFSQ---DPILLAVTAK--LSALQKKVNDVS-YRFKTISS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rogdiNP_730244.1 Rogdi_lz 93..>280 CDD:287261 30/174 (17%)
rav2NP_595763.1 Rogdi_lz 13..269 CDD:287261 39/230 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13618
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.