DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rogdi and H14A12.3

DIOPT Version :9

Sequence 1:NP_730244.1 Gene:rogdi / 39917 FlyBaseID:FBgn0036697 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_498641.1 Gene:H14A12.3 / 176058 WormBaseID:WBGene00019196 Length:292 Species:Caenorhabditis elegans


Alignment Length:281 Identity:79/281 - (28%)
Similarity:130/281 - (46%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PKSAM---KMLADTEREEALNLQIEFEWVLRQEVHAILKQ----------LRSILVECAHRFPVP 123
            ||.|.   :.:.||.|....|   |..|:.|::|...|:.          :.::..:|..|..|.
 Worm    14 PKPASPNPQDIRDTIRSNKTN---ENLWIQRKDVDTTLRSALEHLKACCIVLNLSAKCDERLNVA 75

  Fly   124 LYENEGKKTEKFILTVSPDQLKAVLTLTGDAITQADISFKLCKAPSQTQRTSITHDSPWKLQQVQ 188
            :.....:|.:....|.|.|.|||.:||..|.:.||:::.|..||.....|.....|..|||||:|
 Worm    76 VSHGTTEKYQLMSRTGSSDNLKAAVTLLDDNVIQAEVTVKYPKAGGGYYRAVAQPDVQWKLQQLQ 140

  Fly   189 DAANH----------LQTAINHI--DDVDDSYHFKTSDEVLHVIGNILDALQRGRNSLLVPKKKP 241
            |..||          ||..:|.:  |...|::...|...:|..:...::.:...|||:::|:|:.
 Worm   141 DLGNHISRVTITLCDLQHEVNLLKGDGERDAFTLATGARILEELKLTMNEISLARNSIMLPRKRS 205

  Fly   242 IDELIKGRNMKSLVPNLPEDLAVSFYLQSHKLIIAVYQL----LNNQGTMRFDSRQAEASVQWLN 302
            :.||......:..||.||:|..:|||:...:|:.|.||:    ::.||...|   .||:.:..|:
 Worm   206 LLELCYFPPTRKFVPPLPQDQLISFYISCCRLVCASYQMVPKTVHPQGLSVF---MAESQLPHLD 267

  Fly   303 DVLLLLMNGQKLCQQLKDKIS 323
            ||:..|.....:.|:|.:.:|
 Worm   268 DVIKHLNTVMAILQKLINYLS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rogdiNP_730244.1 Rogdi_lz 93..>280 CDD:287261 59/208 (28%)
H14A12.3NP_498641.1 Rogdi_lz 90..>251 CDD:287261 51/160 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159075
Domainoid 1 1.000 91 1.000 Domainoid score I4875
eggNOG 1 0.900 - - E1_KOG3992
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3606
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46596
OrthoDB 1 1.010 - - D1051737at2759
OrthoFinder 1 1.000 - - FOG0007220
OrthoInspector 1 1.000 - - oto20487
orthoMCL 1 0.900 - - OOG6_107253
Panther 1 1.100 - - LDO PTHR13618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2769
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.