DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CAPS2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006719711.2 Gene:CAPS2 / 84698 HGNCID:16471 Length:614 Species:Homo sapiens


Alignment Length:152 Identity:39/152 - (25%)
Similarity:70/152 - (46%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FNSFDHQKTGSIPTEMVAD-ILRLMGQPFDKKILEEL----IEEVD----EDKSGRLEFGEFVQL 75
            |.|.||.   |:|..:..: :|:|.....|:..|:.|    :|:.|    ::.:.||.|      
Human   373 FLSSDHL---SLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQETNDRLVF------ 428

  Fly    76 AAKFIVEEDAEAMQKE-------LREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIE 133
              |.|.:...|.:.|.       |.:.|:..||:|||.:.....|:.||....:::|::.:....
Human   429 --KAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWL 491

  Fly   134 EIDSDGSGTVDFDEFMEMMTGE 155
            .::.:|:|.||:.||...:.||
Human   492 ILNDNGNGKVDYGEFKRGIIGE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 37/148 (25%)
CAPS2XP_006719711.2 YajQ_like <408..>444 CDD:294471 9/43 (21%)
EF-hand_7 450..510 CDD:290234 17/59 (29%)
EFh 454..510 CDD:238008 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.