DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CML38

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001185413.1 Gene:CML38 / 843998 AraportID:AT1G76650 Length:177 Species:Arabidopsis thaliana


Alignment Length:155 Identity:55/155 - (35%)
Similarity:73/155 - (47%) Gaps:16/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVDEDLTPEQIAVLQKAFNSFDHQKTGSI-PTEMVADILRLMGQPFDKKILEELIEEV---DED 62
            ||..||...|    |:..|:..|..:.|.| |.|:....:.|..|..|    ||.:..|   |.|
plant    34 SSNGEDKNRE----LEAVFSYMDANRDGRISPEELQKSFMTLGEQLSD----EEAVAAVRLSDTD 90

  Fly    63 KSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQE 127
            ..|.|:|.||.||    |..:|.|..:.||:.|||||..:|...|....||.:||:|.:..|..:
plant    91 GDGMLDFEEFSQL----IKVDDEEEKKMELKGAFRLYIAEGEDCITPRSLKMMLKKLGESRTTDD 151

  Fly   128 LDIMIEEIDSDGSGTVDFDEFMEMM 152
            ..:||...|.:..|.:.||||..||
plant   152 CRVMISAFDLNADGVLSFDEFALMM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 53/151 (35%)
CML38NP_001185413.1 PTZ00183 38..177 CDD:185503 53/151 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.