DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CAM4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001185330.1 Gene:CAM4 / 842959 AraportID:AT1G66410 Length:159 Species:Arabidopsis thaliana


Alignment Length:157 Identity:57/157 - (36%)
Similarity:98/157 - (62%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDH----------QKTGSIPTEMVADILRLMGQPFDKKILEELIEEVD 60
            :.||.|||:..::||:.||.          ...|.|.|:.:..::|.:||...:..|:::|.|||
plant     3 DQLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQDMINEVD 67

  Fly    61 EDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTE 125
            .|.:|.::|.||:.|.||.:.:.|:|   :||:||||::||..||||....|:.::..|.::||:
plant    68 ADGNGTIDFPEFLNLMAKKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD 129

  Fly   126 QELDIMIEEIDSDGSGTVDFDEFMEMM 152
            :|::.||.|.|.||.|.::::||:::|
plant   130 EEVEEMIREADVDGDGQINYEEFVKIM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 57/157 (36%)
CAM4NP_001185330.1 PTZ00184 1..159 CDD:185504 57/157 (36%)
EFh <36..84 CDD:238008 17/47 (36%)
EFh 95..157 CDD:238008 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.