DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT1G24620

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_173866.1 Gene:AT1G24620 / 839076 AraportID:AT1G24620 Length:186 Species:Arabidopsis thaliana


Alignment Length:142 Identity:51/142 - (35%)
Similarity:78/142 - (54%) Gaps:3/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLA 76
            :|..|:..|..||....|.|.::.:..|:..:|....::.||:.|.|:|....|.:.|.|||:|.
plant    34 EIRELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEEFVELN 98

  Fly    77 AKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSG 141
            .|.:.:.|   :.:.|::||.:||..|||.|....|.|:|:.|.|:.:..|...||..:|.||.|
plant    99 TKGMDQND---VLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGVDKDGDG 160

  Fly   142 TVDFDEFMEMMT 153
            |:||:||..|||
plant   161 TIDFEEFKIMMT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 49/140 (35%)
AT1G24620NP_173866.1 PTZ00184 34..172 CDD:185504 49/140 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.