DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT1G21550

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_564143.1 Gene:AT1G21550 / 838756 AraportID:AT1G21550 Length:155 Species:Arabidopsis thaliana


Alignment Length:149 Identity:37/149 - (24%)
Similarity:70/149 - (46%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMG----QPFDKKILEELIEEVDEDKSGRLEFGEFVQLA 76
            |::.|.:.|..:.|.:..:.:..||..:|    .|.:   ||.::.:...|....|.|.....|.
plant    11 LRRMFKTLDKNQDGLVTLDELLWILDKLGWAEHTPDE---LELIVGKQSLDLDEFLRFYYDAVLD 72

  Fly    77 AK------FIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKEL--DDQLTEQELDIMIE 133
            :|      .:|.::.||:.:    ||.::|..|:|:|....|:::|:.|  :::....:...||.
plant    73 SKGSKKNIDVVADNDEAIAR----AFNVFDVNGDGYISAEELRDVLERLGFEEEAKAWDCGRMIR 133

  Fly   134 EIDSDGSGTVDFDEFMEMM 152
            ..|.:..|.|||:||..|:
plant   134 VHDKNLDGFVDFEEFKNMI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 37/149 (25%)
AT1G21550NP_564143.1 FRQ1 8..154 CDD:227455 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.