DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT1G18210

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_173259.1 Gene:AT1G18210 / 838401 AraportID:AT1G18210 Length:170 Species:Arabidopsis thaliana


Alignment Length:144 Identity:47/144 - (32%)
Similarity:75/144 - (52%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQ 74
            ||:   |:|.|:.||....|.|....:..:.:.||..:.:..|..::||||.|:.|.:...||..
plant    21 PEE---LKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEFST 82

  Fly    75 LAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDG 139
            |..       :.:...|:|:||.|||:..||.|..:.|.::|..|....:.::...||..:|:||
plant    83 LCR-------SSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADG 140

  Fly   140 SGTVDFDEFMEMMT 153
            .|.|:|:||.:|||
plant   141 DGNVNFEEFQKMMT 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 45/142 (32%)
AT1G18210NP_173259.1 PTZ00184 22..154 CDD:185504 44/141 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.