DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CEN2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001031798.1 Gene:CEN2 / 829855 AraportID:AT4G37010 Length:171 Species:Arabidopsis thaliana


Alignment Length:145 Identity:50/145 - (34%)
Similarity:83/145 - (57%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEF 72
            ||.::...:::.|:.||...:|||....:...:|.:|...:.:.:.||:.|||:::||.::|.||
plant    24 LTNQKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEF 88

  Fly    73 VQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDS 137
            |.:......|.|:   ..||.:||::.|...||.|....:|.|.|||.:..|:.:::.||||.|.
plant    89 VHMMTTKFGERDS---IDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADR 150

  Fly   138 DGSGTVDFDEFMEMM 152
            |..|.|:.:|||:||
plant   151 DKDGEVNLEEFMKMM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 50/145 (34%)
CEN2NP_001031798.1 PTZ00183 15..169 CDD:185503 50/145 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.