DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CAPS

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_004049.3 Gene:CAPS / 828 HGNCID:1487 Length:189 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:68/163 - (41%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFI 80
            |.:.|...|...:.|:..:.....|..:|...|:...|.:..:.|.:.||.|:..||:: |.:..
Human    26 LARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLR-ALRPP 89

  Fly    81 VEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEIL------KELDDQLTEQE-LDIMIEEIDS- 137
            :.:..||:   :..||...|:.|:|.:....|:.:.      |....:.||.| |...::..|| 
Human    90 MSQAREAV---IAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDSS 151

  Fly   138 --DGSGTV----DF-----------DEFMEMMT 153
              ||..|:    |:           :||:.|||
Human   152 EKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 37/161 (23%)
CAPSNP_004049.3 EFh_PI-PLC 26..165 CDD:333715 33/142 (23%)
EFh 26..87 CDD:238008 15/61 (25%)
EF-hand motif 26..54 CDD:320029 5/27 (19%)
EF-hand motif 61..89 CDD:320029 8/28 (29%)
EF-hand motif 94..131 CDD:320029 9/39 (23%)
EF-hand motif 139..165 CDD:320029 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.