DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CAM9

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:144 Identity:46/144 - (31%)
Similarity:79/144 - (54%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFV 73
            |.|||....:||...|....|.|..|.:..:::.||:....:.|::::.:||...:|.:.|.:|:
plant     6 TDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGITFDDFL 70

  Fly    74 QLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSD 138
            .:.|:...:|.|   ..||.|.||::|:.|:|.|....|.|.:|::..::|.:|.:.|:.|.|.|
plant    71 YIMAQNTSQESA---SDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREADLD 132

  Fly   139 GSGTVDFDEFMEMM 152
            |.|.:.|.||.:||
plant   133 GDGFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 46/144 (32%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 46/144 (32%)
EFh 12..74 CDD:238008 14/61 (23%)
EFh 85..146 CDD:238008 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.