DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT3G25600

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_189188.4 Gene:AT3G25600 / 822147 AraportID:AT3G25600 Length:161 Species:Arabidopsis thaliana


Alignment Length:143 Identity:49/143 - (34%)
Similarity:79/143 - (55%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSGRLEFGEFVQ 74
            :||..|:..|..||..|.||:....:|.:||.:| :|...:| ..|:.::|.:.:|.:||.|.| 
plant     8 DQIKQLKDIFARFDMDKDGSLTQLELAALLRSLGIKPRGDQI-SLLLNQIDRNGNGSVEFDELV- 70

  Fly    75 LAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDG 139
            :|....:.|:....|::|.|.||.:|:.|||.|....|...:.::...||.:||..|:.|.||:|
plant    71 VAILPDINEEVLINQEQLMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMMTEADSNG 135

  Fly   140 SGTVDFDEFMEMM 152
            .|.:.|:||..:|
plant   136 DGVISFNEFSHIM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 49/143 (34%)
AT3G25600NP_189188.4 PTZ00184 1..148 CDD:185504 48/141 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.