DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT3G03400

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_186990.1 Gene:AT3G03400 / 821266 AraportID:AT3G03400 Length:137 Species:Arabidopsis thaliana


Alignment Length:136 Identity:38/136 - (27%)
Similarity:67/136 - (49%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKF- 79
            |...|..||..|.|.|..|...|.:..:......:.|.|:..::|.:..|:::       |||| 
plant     6 LSDIFERFDTSKDGKISWEEFRDAIHALSPSIPSEKLVEMFIQLDTNGDGQVD-------AAKFA 63

  Fly    80 -IVEEDAEA----MQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDG 139
             .:::.|::    ::|||::||:|||...:|.|....|..::..|.::.|.:....|::.||.||
plant    64 SCMDQTAQSSGGDVEKELKDAFKLYDINCDGKISANELHVVMTRLGEKCTVESCVGMVQAIDVDG 128

  Fly   140 SGTVDF 145
            .|.:.|
plant   129 DGYIRF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 38/136 (28%)
AT3G03400NP_186990.1 PTZ00184 10..134 CDD:185504 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.