DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AT3G01830

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_566152.1 Gene:AT3G01830 / 820033 AraportID:AT3G01830 Length:146 Species:Arabidopsis thaliana


Alignment Length:146 Identity:49/146 - (33%)
Similarity:81/146 - (55%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKAFNSFD--HQKTGSIPT-EMVADILRLMGQPFDKKILEE------LIEEVDEDKSGRLEFGEF 72
            |:.|:.||  ||...|:.| |...|.:: .|:   :.::::      ..||..:|||  ||..:|
plant    13 QRVFSCFDKSHQGKVSVSTIERCVDAIK-SGK---RAVVDQEDTTNPNPEESTDDKS--LELEDF 71

  Fly    73 VQLAAKFIVEEDAEA-MQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |:|     |||..|| .:|:|:|||:||: :..|..|.: ||.:|..|.:..:.::.::||.:.|
plant    72 VKL-----VEEGEEADKEKDLKEAFKLYE-ESEGITPKS-LKRMLSLLGESKSLKDCEVMISQFD 129

  Fly   137 SDGSGTVDFDEFMEMM 152
            .:..|.::||||..||
plant   130 INRDGIINFDEFRAMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 49/146 (34%)
AT3G01830NP_566152.1 PTZ00184 11..145 CDD:185504 47/144 (33%)
EFh 86..146 CDD:238008 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.