DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and TCH3

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001189723.1 Gene:TCH3 / 818709 AraportID:AT2G41100 Length:324 Species:Arabidopsis thaliana


Alignment Length:164 Identity:56/164 - (34%)
Similarity:89/164 - (54%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFG 70
            :.||.:||...:::|..||....|||..:.:..::..:|:...|..|::::.|||.|..|.::|.
plant    92 DKLTDDQITEYRESFRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFP 156

  Fly    71 EFVQLAAKFIVEEDAEAMQK--------------ELREAFRLYDKQGNGFIPTTCLKEILKELDD 121
            ||:.|.||....:.|....|              |.|||||::||.|:|:|....|:..::.|.:
plant   157 EFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGE 221

  Fly   122 QLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE 155
            ..|:.||..||.|.|:||.||:.|.||:.:|||:
plant   222 TQTKAELQDMINEADADGDGTISFSEFVCVMTGK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 53/160 (33%)
TCH3NP_001189723.1 PTZ00184 1..162 CDD:185504 21/69 (30%)
PTZ00184 90..255 CDD:185504 55/162 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.