DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Calm4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_064420.2 Gene:Calm4 / 80796 MGIID:1931464 Length:148 Species:Mus musculus


Alignment Length:143 Identity:51/143 - (35%)
Similarity:81/143 - (56%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFV 73
            |.|::|..|.|||.||..|.|.|..|.:.|:::.:|:...:|.|:.||.::|.|..|::.|.||:
Mouse     6 TKEEVAEFQAAFNRFDKNKDGHISVEELGDVMKQLGKNLPEKDLKALISKLDTDGDGKISFEEFL 70

  Fly    74 QLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSD 138
            ....|:.....|    .|||..|.:.|:.|:|:|....|||.|.:|.:.|:::||:.||...|.|
Mouse    71 TAIEKYKKGHRA----GELRAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVADVD 131

  Fly   139 GSGTVDFDEFMEM 151
            ..|.|.::||:.:
Mouse   132 QDGKVKYEEFVRL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 51/143 (36%)
Calm4NP_064420.2 PTZ00184 1..148 CDD:185504 51/143 (36%)
EFh 12..73 CDD:238008 22/60 (37%)
EFh 84..145 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.