DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cetn4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_002667227.2 Gene:cetn4 / 795310 ZFINID:ZDB-GENE-030826-21 Length:171 Species:Danio rerio


Alignment Length:146 Identity:48/146 - (32%)
Similarity:90/146 - (61%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            :||.||...:::||:.||...:|:|..:.:...:|.:|....|:.::::|.::|::.||.:.|.:
Zfish    23 ELTEEQKQEIKEAFDLFDTDGSGTIDVKELKVAMRALGFEPKKEEIKKMIADIDKEGSGVIGFSD 87

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |:.:..:.:.|:|:   ::|:.:||||:|....|.|....||.:.|||.:.||::||..||:|.|
Zfish    88 FLSMMTQKMSEKDS---KEEILKAFRLFDDDCTGKISFKNLKRVAKELGENLTDEELQEMIDEAD 149

  Fly   137 SDGSGTVDFDEFMEMM 152
            .||.|.::..||:.:|
Zfish   150 RDGDGEINEQEFLRIM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 48/146 (33%)
cetn4XP_002667227.2 PTZ00183 15..171 CDD:185503 48/146 (33%)
EFh 31..93 CDD:238008 15/61 (25%)
EFh 104..166 CDD:238008 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.