DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cabp4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_012822201.1 Gene:cabp4 / 780009 XenbaseID:XB-GENE-6074603 Length:263 Species:Xenopus tropicalis


Alignment Length:154 Identity:50/154 - (32%)
Similarity:84/154 - (54%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSGR 66
            |.:.||.||:|..|..||..||..:.|.|..:.:.:.:|.|| .|.:.::: |:.:.:.....||
 Frog   109 SKERDLAPEEIDELHAAFVEFDADQDGFIGYKELGECMRTMGYMPTEMELI-EISQHIKMRMGGR 172

  Fly    67 LEFGEFVQL-AAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKE-LDDQLTEQELD 129
            ::|.:||:| ..|.:.|.:.....:||:.|||.:|..|:|.|....|.:..:. |...|...|:.
 Frog   173 IDFEDFVELIGPKMLAETENMVGVRELKIAFREFDVNGDGHISGLELHDAAQTFLGQPLNSSEVQ 237

  Fly   130 IMIEEIDSDGSGTVDFDEFMEMMT 153
            .:|.::|.:|.|.||||||:.|::
 Frog   238 EIIHDVDLNGDGRVDFDEFVMMLS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 49/149 (33%)
cabp4XP_012822201.1 PTZ00184 114..263 CDD:185504 48/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.