DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Efcab6

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006521594.2 Gene:Efcab6 / 77627 MGIID:1924877 Length:1536 Species:Mus musculus


Alignment Length:164 Identity:29/164 - (17%)
Similarity:66/164 - (40%) Gaps:41/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DHQKTGSIPTEMVADILRLMGQ---PFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDA 85
            |..|.|:|   ..|:.|.|:.:   ...::..::||.:.|...:|:..:.:|:|.....:..::.
Mouse  1371 DTDKQGTI---SAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKET 1432

  Fly    86 EAMQ-----------------------------------KELREAFRLYDKQGNGFIPTTCLKEI 115
            ..|:                                   :.:|.:|:.|||.|.|.:.....:::
Mouse  1433 SLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKV 1497

  Fly   116 LKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149
            |::....|:|:|...::|..|...|..:.:::|:
Mouse  1498 LRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFL 1531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 29/164 (18%)
Efcab6XP_006521594.2 FRQ1 119..285 CDD:227455
FRQ1 338..501 CDD:227455
EFh_PEF 787..>952 CDD:355382
EF-hand motif 787..823 CDD:320054
EF-hand motif 828..889 CDD:320054
EF-hand motif 890..922 CDD:320054
EFh_PI-PLC 894..1004 CDD:333715
EF-hand motif 894..922 CDD:320029
EF-hand_7 898..952 CDD:372618
EF-hand motif 929..954 CDD:320029
EF-hand_11 1197..1301 CDD:370222
PTZ00183 1364..1532 CDD:185503 29/164 (18%)
EF-hand_7 1474..1534 CDD:372618 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.