DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Cabp4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_036017598.1 Gene:Cabp4 / 73660 MGIID:1920910 Length:297 Species:Mus musculus


Alignment Length:149 Identity:54/149 - (36%)
Similarity:82/149 - (55%) Gaps:4/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKS 64
            |...|.:|.||::..||.||..||..:.|.|....:.|.:|.:| .|.:.::| |:.:.|.....
Mouse   115 MFGKDRELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELL-EVSQHVKMRMG 178

  Fly    65 GRLEFGEFVQLAAKFIVEEDAEAM-QKELREAFRLYDKQGNGFIPTTCLKEILKE-LDDQLTEQE 127
            |.::|.|||:|.:..:.||.|..: .:|||.|||.:||..:|.|....|::.... |.:.|...|
Mouse   179 GFVDFEEFVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTE 243

  Fly   128 LDIMIEEIDSDGSGTVDFD 146
            ||.|:.|:|.:|.||:|||
Mouse   244 LDEMLREMDLNGDGTIDFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 52/144 (36%)
Cabp4XP_036017598.1 PTZ00184 133..262 CDD:185504 45/129 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.