DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Calml4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:80/147 - (54%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSI-PTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            |:.|||...::.|:.:|.|:.|.| .|:::..:..|...|...::...| :....||:|.|:|..
  Rat     5 LSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHL-QTHGIDKNGELDFST 68

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |:.:....|.:||.   :||:..|..:.||:..|:|..:.|:..|.:|.::||.:|:|.:.:|..
  Rat    69 FLTIMHMQIKQEDP---KKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKEAG 130

  Fly   137 SDGSGTVDFDEFMEMMT 153
            .:.:|.|.:|.|::.:|
  Rat   131 IEPNGQVKYDTFIQRIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 41/145 (28%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 41/142 (29%)
EFh 12..74 CDD:238008 15/62 (24%)
EFh 94..147 CDD:298682 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.