DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and EFCAB6

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_011528618.1 Gene:EFCAB6 / 64800 HGNCID:24204 Length:1613 Species:Homo sapiens


Alignment Length:149 Identity:29/149 - (19%)
Similarity:55/149 - (36%) Gaps:29/149 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELI------------------------ 56
            :.|||...|..||..|....:.::|...|....:..|..|:                        
Human   995 ISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENS 1059

  Fly    57 -----EEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEIL 116
                 :..::::|..:.|.......|...::|..|:.|..|..||...||:..||:..|...::|
Human  1060 KSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVL 1124

  Fly   117 KELDDQLTEQELDIMIEEI 135
            |:...:||:.:....:.::
Human  1125 KDFCYKLTDNQYHYFLRKL 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 29/149 (19%)
EFCAB6XP_011528618.1 EFh 100..152 CDD:298682
EF-hand_7 203..261 CDD:290234
EFh 203..261 CDD:298682
FRQ1 320..495 CDD:227455
EFh 434..494 CDD:238008
FRQ1 989..1135 CDD:227455 29/139 (21%)
EF-hand_11 1186..1286 CDD:286115
EFh 1211..1264 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.