DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CABP4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_011543483.1 Gene:CABP4 / 57010 HGNCID:1386 Length:295 Species:Homo sapiens


Alignment Length:152 Identity:57/152 - (37%)
Similarity:88/152 - (57%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSGRLE 68
            |.:|.||::..||.||..||..:.|.|....:.|.:|.:| .|.:.::| |:.:.:.....||::
Human   143 DRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELL-EVSQHIKMRMGGRVD 206

  Fly    69 FGEFVQLAAKFIVEEDAEAM-QKELREAFRLYDKQGNGFIPTTCLKEILKE-LDDQLTEQELDIM 131
            |.|||:|....:.||.|..: .:|||.|||.:|:..:|.|....|:|.:.. |.:.|...|||.|
Human   207 FEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEM 271

  Fly   132 IEEIDSDGSGTVDFDEFMEMMT 153
            :.|:|.:|.||||||||:.|::
Human   272 LREVDLNGDGTVDFDEFVMMLS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 56/149 (38%)
CABP4XP_011543483.1 PHA03415 81..>190 CDD:177643 16/46 (35%)
PTZ00184 145..294 CDD:185504 56/150 (37%)
EFh 153..214 CDD:238008 20/61 (33%)
EFh 230..293 CDD:238008 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.