DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and DUOX1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_059130.2 Gene:DUOX1 / 53905 HGNCID:3062 Length:1551 Species:Homo sapiens


Alignment Length:109 Identity:31/109 - (28%)
Similarity:47/109 - (43%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PFD--KKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIP 108
            |.|  :|:.|.|..|:     .|.||.|.:.|..:.:..|          ..|.|.||.|||::.
Human   787 PLDSSQKVREALTCEL-----SRAEFAESLGLKPQDMFVE----------SMFSLADKDGNGYLS 836

  Fly   109 TTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152
            .....:||........|::..:|....|.||:|.:..|||:.|:
Human   837 FREFLDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRML 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 31/109 (28%)
DUOX1NP_059130.2 Peroxidase-like, mediates peroxidase activity 26..593
An_peroxidase 30..544 CDD:281139
dual_peroxidase_like 32..591 CDD:188652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..172
EFh 820..881 CDD:238008 20/71 (28%)
EF-hand_7 820..880 CDD:290234 19/69 (28%)
EF-hand_7 857..921 CDD:290234 9/24 (38%)
EFh 857..915 CDD:238008 9/24 (38%)
Interaction with TXNDC11. /evidence=ECO:0000250 956..1248
Ferric_reduct 1091..1226 CDD:280043
NOX_Duox_like_FAD_NADP 1277..1551 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.