DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CABP2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001305425.1 Gene:CABP2 / 51475 HGNCID:1385 Length:226 Species:Homo sapiens


Alignment Length:155 Identity:55/155 - (35%)
Similarity:93/155 - (60%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSG 65
            :|.|.:|.||:|..||.||..||..:.|.|....:...:|.:| .|.:.    ||||...:...|
Human    75 NSYDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEM----ELIEISQQISGG 135

  Fly    66 RLEFGEFVQLAAKFIVEEDAEAM-QKELREAFRLYDKQGNGFIPTTCLKEILKE-LDDQLTEQEL 128
            :::|.:||:|....::.|.|:.: .:|||:|||.:|..|:|.|....|:..||. |.::|:::|:
Human   136 KVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREV 200

  Fly   129 DIMIEEIDSDGSGTVDFDEFMEMMT 153
            |.:::::|.:|.|.|||:||:.||:
Human   201 DEILQDVDLNGDGLVDFEEFVRMMS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 52/149 (35%)
CABP2NP_001305425.1 FRQ1 78..226 CDD:227455 54/152 (36%)
EF-hand_6 88..117 CDD:290141 9/28 (32%)
EF-hand_8 133..188 CDD:290545 18/54 (33%)
EFh 162..225 CDD:238008 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.