Sequence 1: | NP_001287091.1 | Gene: | TpnC73F / 39916 | FlyBaseID: | FBgn0010424 | Length: | 155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008706.1 | Gene: | Calm5 / 494124 | MGIID: | 3511177 | Length: | 140 | Species: | Mus musculus |
Alignment Length: | 126 | Identity: | 36/126 - (28%) |
---|---|---|---|
Similarity: | 72/126 - (57%) | Gaps: | 7/126 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 DHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAM 88
Fly 89 QKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TpnC73F | NP_001287091.1 | PTZ00184 | 6..153 | CDD:185504 | 36/126 (29%) |
Calm5 | NP_001008706.1 | EFh | 10..56 | CDD:238008 | 12/45 (27%) |
EFh | 35..94 | CDD:238008 | 21/65 (32%) | ||
EF-hand_7 | 36..91 | CDD:290234 | 19/61 (31%) | ||
EFh | 68..128 | CDD:238008 | 20/66 (30%) | ||
EF-hand_7 | 69..129 | CDD:290234 | 20/65 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23050 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |