DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Eip63F-1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:77/160 - (48%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFV 73
            |..:|..|:.||:..|..:.|.:....:..:|:.:|.....:::.:||.|.....:|.:...||:
  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97

  Fly    74 QLAAKFIVEED----------------AEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQ 122
            |...:.....|                |:.:.::|..|||::|:.|||||....|:..::.:.:.
  Fly    98 QWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEP 162

  Fly   123 LTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152
            |.||:|:.::...|.|..|.::::||..::
  Fly   163 LNEQQLEQLLVIADLDQDGRINYEEFTRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 38/160 (24%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 38/160 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.