DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP006178

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_316241.3 Gene:AgaP_AGAP006178 / 4576643 VectorBaseID:AGAP006178 Length:171 Species:Anopheles gambiae


Alignment Length:155 Identity:83/155 - (53%)
Similarity:118/155 - (76%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGR 66
            |...::|:.:|:.||:.|||:||.:|||||||::|..||.|:|....::.|:|:|||.|||:||:
Mosquito    14 SGAGKELSKDQLKVLRDAFNAFDKEKTGSIPTDVVGTILELLGHKLSEEELDEVIEEYDEDESGQ 78

  Fly    67 LEFGEFVQLAAKFI-VEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDI 130
            |||.|||.||:.:: .|||.||::|||||.|.:|||...|::|....|.||:|||..:.|:|||.
Mosquito    79 LEFEEFVALASNYVEPEEDYEALRKELREVFMMYDKDAKGYLPVEEFKAILRELDGAVPEEELDD 143

  Fly   131 MIEEIDSDGSGTVDFDEFMEMMTGE 155
            :::|||:||||||||:||||:||.:
Mosquito   144 IVDEIDADGSGTVDFEEFMEVMTAD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 80/147 (54%)
AgaP_AGAP006178XP_316241.3 FRQ1 13..168 CDD:227455 83/153 (54%)
EFh 28..89 CDD:298682 35/60 (58%)
EFh 104..166 CDD:238008 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.