DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CG10126

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:170 Identity:36/170 - (21%)
Similarity:63/170 - (37%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFI 80
            |.:||.:.|...:.::..|.....:|..|....::.::::....|||.||.:...|       |:
  Fly    62 LGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTE-------FL 119

  Fly    81 VEEDAEAMQKELR---EAFRLYDKQGNGFIPTTCLK-------------------EILKE----- 118
            ::......|..|.   :||...|:..:|.|....||                   |||.:     
  Fly   120 LKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNF 184

  Fly   119 ------LDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152
                  ||.::|.:|.......|    |.::|.|.|.::|
  Fly   185 EGGRGNLDGKITREEFVNYYATI----SASIDNDMFFDLM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 36/170 (21%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/63 (21%)
EFh 64..119 CDD:238008 12/61 (20%)
EFh 97..154 CDD:238008 14/63 (22%)
EF-hand_7 98..158 CDD:290234 16/66 (24%)
EF-hand_7 134..204 CDD:290234 14/69 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.