DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CG31345

DIOPT Version :10

Sequence 1:NP_524122.2 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster


Alignment Length:96 Identity:18/96 - (18%)
Similarity:40/96 - (41%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 VLKYEEVKKEAAVRLSSLYDEIR-PAIEEHERDSQDSVATSVAEKWIQASCNKLKAEFDLYSSVI 460
            :|:..|...:.|:|..::...|: ..|.|..:.:.:|:.......||   |........::::.:
  Fly     6 ILRLPEKSLKIAIRCLTMEQIIKFSLISESTKRTAESLNLQADPFWI---CFGESVHISVHANFV 67

  Fly   461 KN----IASTPIKPQDTKTKVAEAGNEDHIK 487
            :|    |...|:: .|.:|.:      ||.:
  Fly    68 ENYQQDIPWNPVE-VDLRTLL------DHFQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_524122.2 PTZ00184 6..153 CDD:185504
CG31345NP_731744.1 FRQ1 48..186 CDD:444056 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.