DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and calm1a

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_998516.1 Gene:calm1a / 406660 ZFINID:ZDB-GENE-030131-8308 Length:149 Species:Danio rerio


Alignment Length:150 Identity:60/150 - (40%)
Similarity:102/150 - (68%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFG 70
            :.||.||||..::||:.||....|:|.|:.:..::|.:||...:..|:::|.|||.|.:|.::|.
Zfish     3 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

  Fly    71 EFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEI 135
            ||:.:.|:.:.:.|:|   :|:|||||::||.|||:|....|:.::..|.::||::|:|.||.|.
Zfish    68 EFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREA 129

  Fly   136 DSDGSGTVDFDEFMEMMTGE 155
            |.||.|.|:::||::|||.:
Zfish   130 DIDGDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 58/146 (40%)
calm1aNP_998516.1 PTZ00184 1..149 CDD:185504 60/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.