DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and efhd1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_989300.1 Gene:efhd1 / 394919 XenbaseID:XB-GENE-5738953 Length:236 Species:Xenopus tropicalis


Alignment Length:81 Identity:27/81 - (33%)
Similarity:42/81 - (51%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIE 133
            :.||.:.:.|.|  :|.|||       |:.||...:|||....||.::::|....|...|..||:
 Frog    78 YTEFKEFSRKQI--KDMEAM-------FKKYDSGKDGFIDMMELKFLMEKLGAPQTHLGLKNMIK 133

  Fly   134 EIDSDGSGTVDFDEFM 149
            |:|.|....::|.||:
 Frog   134 EVDEDFDNKLNFREFL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 27/81 (33%)
efhd1NP_989300.1 EFh 91..149 CDD:238008 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.