DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CG13526

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster


Alignment Length:146 Identity:35/146 - (23%)
Similarity:70/146 - (47%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            :||.|.|..|:.||..:|....|::....|...|..:|....:..|.:||..|......||:..:
  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |:::.|..:...|::   |.|...|.:.|:..:|::....::.|:..|.:.:|:.::..:.:.:|
  Fly    73 FIRMMAPRMANVDSD---KSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVD 134

  Fly   137 SDGSGTVDFDEFMEMM 152
            .||.|.:...:|:..|
  Fly   135 MDGDGRISLRDFVGFM 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 35/146 (24%)
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 35/146 (24%)
EFh 16..78 CDD:238008 15/61 (25%)
EFh 92..151 CDD:238008 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.