DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and SPATA21

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_016856705.1 Gene:SPATA21 / 374955 HGNCID:28026 Length:711 Species:Homo sapiens


Alignment Length:132 Identity:36/132 - (27%)
Similarity:57/132 - (43%) Gaps:13/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPTEMVADILRLMGQPFD-----KKILEELIEEVDEDKSGRLEFGEFVQLAAKFIV--EEDAEAM 88
            :||.|...:  |:|...|     .::|.:..|........|.|..|  |...|...  |:..|.:
Human   384 VPTSMPCPV--LLGPALDLGWRRMELLHQSSERTLSYAKARQEPEE--QSLQKLYQNREKSEEQL 444

  Fly    89 QKELREAFRLYDK--QGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEM 151
            ..:..||||.|.:  .|.|.:....||.||..:...:|..:::..:...|.:|.|.|||.:|:.:
Human   445 TLKQEEAFRSYFEIFNGPGEVDAQSLKNILLLMGFSVTLAQVEDALMSADVNGDGRVDFKDFLAV 509

  Fly   152 MT 153
            ||
Human   510 MT 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 34/130 (26%)
SPATA21XP_016856705.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.