DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CG9406

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:58/118 - (49%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDE-DKSGRLEFGEFVQLAAKF 79
            :.:||..||......|.:..|.::||.:|....:|.:|::|:..|. |..|.....:|::..:|.
  Fly    15 ISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEAHLVKFMEHVSKL 79

  Fly    80 IVEEDAE-AMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIM 131
            :::...| |..::|.|||...|.:...::......:::.|..:..:.:|||.|
  Fly    80 LMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEELDAM 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 29/118 (25%)
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 29/118 (25%)
EFh 14..>59 CDD:298682 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.