DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Caps2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006241399.1 Gene:Caps2 / 366891 RGDID:1309826 Length:589 Species:Rattus norvegicus


Alignment Length:156 Identity:37/156 - (23%)
Similarity:68/156 - (43%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FNSFDHQKTGSIPTEMVAD-ILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEE 83
            |.|.||.   |:|..:..: :|||.....|:..|:.|       |:...|.|....::.:...:.
  Rat   345 FLSCDHP---SLPKSIKENALLRLRITSIDQVALDSL-------KAASAEPGREDPVSQEAQDQL 399

  Fly    84 DAEAMQKELREA---------------FRLYDKQGNGFIPTTCLKEILKELDDQLTEQELD---- 129
            ..:|:|::|:|.               |:..||:|||.:..|..::.|:....:::||:.:    
  Rat   400 VLQAIQEKLKEQLHTKGVRILTGLGKYFQRLDKEGNGLLEKTDFQQALETFHLEVSEQDFESSWL 464

  Fly   130 IMIEEIDSDGSGTVDFDEFMEMMTGE 155
            |::....|...  ||:.||...:.||
  Rat   465 ILLGHGHSQNK--VDYGEFKRAIFGE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 35/152 (23%)
Caps2XP_006241399.1 EF-hand_7 423..485 CDD:290234 16/63 (25%)
PTZ00183 482..>574 CDD:185503 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.