DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Spata21

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_038966414.1 Gene:Spata21 / 366491 RGDID:1302954 Length:692 Species:Rattus norvegicus


Alignment Length:74 Identity:23/74 - (31%)
Similarity:35/74 - (47%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EEDAEAMQKELREAFRLYDK--QGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVD 144
            |...|.:..:..||||.|..  .|.|.:....||.||..:....|..:::..:...|.:|.|.||
  Rat   432 ERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNGDGHVD 496

  Fly   145 FDEFMEMMT 153
            |.:|:.:||
  Rat   497 FKDFLAVMT 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 21/72 (29%)
Spata21XP_038966414.1 PRK12678 27..>141 CDD:237171
PHA03247 <36..404 CDD:223021
EFh 446..505 CDD:238008 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.