DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Aif1l

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001102048.1 Gene:Aif1l / 362107 RGDID:1305081 Length:150 Species:Rattus norvegicus


Alignment Length:103 Identity:26/103 - (25%)
Similarity:47/103 - (45%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILK 117
            |:.:||::.         ||: ...|:..||:........:|.:..:|....|.|....||.:::
  Rat    23 EKRLEEINR---------EFL-CDQKYSDEENLPEKLAAFKEKYMEFDLNNEGEIDLMSLKRMME 77

  Fly   118 ELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE 155
            :|....|..|:..||.|:....|.|:.:.:|:.||.|:
  Rat    78 KLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 24/99 (24%)
Aif1lNP_001102048.1 PTZ00184 47..>115 CDD:185504 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.