DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and TpnC47D

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster


Alignment Length:155 Identity:144/155 - (92%)
Similarity:152/155 - (98%) Gaps:0/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSG 65
            |.::||||||||||||||||||||||||||||||||||||||||||||::||:|||:||||||||
  Fly     1 MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSG 65

  Fly    66 RLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDI 130
            ||||.||||||||||||||.||||||||||||||||||||:|||:||||||||||||||||||||
  Fly    66 RLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130

  Fly   131 MIEEIDSDGSGTVDFDEFMEMMTGE 155
            |||||||||||||||||||||||||
  Fly   131 MIEEIDSDGSGTVDFDEFMEMMTGE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 138/146 (95%)
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 138/146 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469339
Domainoid 1 1.000 121 1.000 Domainoid score I11229
eggNOG 1 0.900 - - E33208_3BPFZ
Homologene 1 1.000 - - H113978
Inparanoid 1 1.050 258 1.000 Inparanoid score I5529
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126253at33392
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 1 1.000 - - otm14323
orthoMCL 1 0.900 - - OOG6_120788
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7638
1312.750

Return to query results.
Submit another query.