DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and azot

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:149 Identity:51/149 - (34%)
Similarity:88/149 - (59%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSGRLEF 69
            ||::.|:..::...|...|....|:|.::.:|.::|.:| ||.|.:: :.:|.|||.:.:|.:..
  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEV-QSMINEVDSEGNGSIVA 65

  Fly    70 GEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEE 134
            .||..:..:.:.:.:.|   .|||||||::||..||:|.||.||.:...|..:|::.||:.||.|
  Fly    66 PEFCNVILRKMRDTNHE---DELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIRE 127

  Fly   135 IDSDGSGTVDFDEFMEMMT 153
            .|.|....::::||:.|||
  Fly   128 YDLDQDNHLNYEEFVNMMT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 49/147 (33%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 51/149 (34%)
EFh 12..72 CDD:238008 17/60 (28%)
EFh 84..146 CDD:238008 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.